<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1139 1139-30318 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215FY F77FL L100I, K103N   E44D, I50IM, D121H, K122E, S162C, Q174R, D177E, G196E, Q207E, R211K, V245E H235HD
>1139-30318| codons 38-247
CTELEKDGKISKMGPENPYNTPVFAIKKKNSTKWRKVVDLRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKRNPEIVIYQYMDDLYVGSDLEIEQHRTKIEELREHLWKWGFYTP
DKKHQKEPPFLWMGYELDPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, V82VA, L90M L33F, F53L, G73NS, L89V L10I, I13V, E34EQ, R41K, K43R, I62IV, L63P, H69Y, A71V, V77I, I93L  
>1139-30318| codons 4-99
TLWQRPIVTVKIGGQLKEALLDTGADDTIFQEMNLPGKWRPKIVGGIGGLMKVRQYDQVP
IEICGYKVISTVLIGPTPANIIGRNVMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006