<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2359 2359-30814 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M L23I, G73S L10I, K45R, R57K, L63P, A71V, V77VI, I93L  
>2359-30814| codons 4-99
TLWQRPIVTIKIGGQLKEAILDTGADDTVLEEMNLPGRWKPRMIGGIGGFIKVKQYDQIP
IEICGHKVISTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184MIV, L210W, T215Y       V118I, K122E, K173Q, D177E, I178M, T200A, I202V, Q207K, R211K, K223Q, L228H, I244IV  
>2359-30814| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRQQNPEMVIYQYVDDLYVGSDLEIGQHRAKVEELRKHLWKWGFYTP
DKKHQQEPPFHWMGYELHPDKWTVQPVVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006