<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2051 2051-30711 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82T, I84V   L10V, D60E, L63P, A71V  
>2051-30711| codons 4-99
TLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIVGIGGFVKVRQYEQIP
IEICGHKVIGTVLVGPTPTNVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, L210W, T215SY V75VIM, F77FL, K219R     K43Q, E44D, V118I, D123E, I142T, K166R, I178M, E203K, Q207A, R211K, K223E, L228R, V245K  
>2051-30711| codons 38-247
CTELEQDGKISKIGPENPYNTPVFAIKKKDSDKWRKLMDLRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDMVIYQYMDDLYVGSDLEIGQHRTKIKELRAHLWKWGFYTP
DRKHQEEPPFRWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006