<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2493 2493-30821 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, M184V   Y181C   S68N, K173R, Q174E, R211K, V245M  
>2493-30821| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKRKDNTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRRENPDIVICQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V   L10I, I15V, L19I, E35D, N37D, K43R, R57K, D60E, L63P, H69Q  
>2493-30821| codons 5-99
LWQRPIVTIKVGGQIKEALLDTGADDTILEDMDLPGRWRPKMVGGIGGFIKVKQYEQIPI
EICGQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006