<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2494 2494-30821 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M V11VI, L33F, F53L, G73T L10I, I13V, G16A, K20R, L24F, M36MIL, R41K, K55R, I62V, L63P, A71V, I72T  
>2494-30821| codons 4-99
TLWQRPIITVKIAGQLREALFDTGADDTVFEELNLPGKWKPKLIGGIGGLVRVRQYDQVP
IEICGHKVTTTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, Y115F, M184V, L210W, T215Y A62V, V75S Y181C A98G, E138EDKN T58N, S68G, K122E, S134SG, V179I, R211K, H221Y  
>2494-30821| codons 38-247
CTELEKEGKISKIGPENPYNNPVFVIKKKDGTKWRKISDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAFFSVPLDEDFRKYTAFTIPGINNNTPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIICQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTP
DKKYQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006