<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1846 1846-30821 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L10F, L24I I15V, K20T, M36I, R41K, R57K, Q61QE, I62IV, L63P, A71AT  
>1846-30821| codons 4-99
TLWQRPFVTIKVGGQLTEALIDTGADDTVLEEINLPGKWKPKIIGGIGGFVKVKQYDEVP
IEICGHKTIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R       D121DH, K122E, D123DAE, D177E, I178M, Q197K, T200A, Q207E, V245E S68SDGN
>1846-30821| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKRKDNTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLHEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEMVIYQYMDDLYVGSDLEIGKHRAKIEELREHLLRWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006