<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1842 1842-30731 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, V82A, I84V, L90M L33F, T74P L10I, I13V, G16A, K20R, E34Q, M36I, N37D, R41K, I62V, L63P, A71V, I72T, I93L  
>1842-30731| codons 4-99
TLWQRPIVTVKIAGQLREALLDTGADDTVFQEIDLPGKWKPKMIGGIGGFLKVRQYDQVP
IEICGHKVTGPVLVGPTPANVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M, M184V A62V, V75I, F116Y, K219E L100I, K103N   S68G, T69TA, K102R, K122E, T139A, G196E, V245E  
>1842-30731| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKDGAKWRKLIDFRELNKRTQDFWEVQLGIPHP
AGIKRNKSVTVLDVGDAFYSVPLDEDFRKYTAFTIPSINNEAPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFTTP
DEKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006