<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1836 1836-30710 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, I54T, V82S K43KT L10I, K20R, E35D, M36I, N37E, I62V, L63A, A71V, T74S, V77I, I93L  
>1836-30710| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTVLEDIELPGRWTPKIIVGIGGFTKVRQYDQVA
IEICGHKVIGSVLIGPTPSNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70KR, L74I, M184V, L210W, T215F K219Q K101KPQT, K103NS   T39LS, V118VI, K122E, S162SN, D177N, T200TI, R211K, D218E, L228H  
>1836-30710| codons 38-247
CSELEKEGKISKIGPENPYNTPVFAIKKKNSDRWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLTKSKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQNSMTKILEPFRKQNPNIVIYQYVDDLYVGSDLEIGQHRIKIEELRQHLWKWGFFTP
EQKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006