<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2161 2161-30708 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L74V, T215F K219Q K103N, Y181C   V60I, K101R, K122E, I135T, I167V, G196E, D218E  
>2161-30708| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSDRWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLRKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKVLEPFRKQNPDIVICQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTP
EQKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82CG, I84IV, L90M F53FL, Q58QE L10I, V11L, I13V, K20V, K55KR, I62V, L63P, A71V, Q92QKR  
>2161-30708| codons 4-99
TLWQRPILTVKIGGQLVEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGLVRVREYDQVP
IEICGHKVIGTVLVGPTPGNVIGRNLMTRIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006