<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1418 1418-30820 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54IV, V82AT, L90M V11I, L33I, K43IMT, F53L, L89V L10V, I13V, K14T, L19T, K20T, E35D, M36I, N37D, K55R, R57K, D60N, I62V, L63P, I66IL, C67L, H69Q, A71I  
>1418-30820| codons 4-99
TLWQRPVITVTIGGQTTEALLDTGADDTIIEDIDLPGRWTPKIVGGIGGLVRVKQYNQVP
IELLGQKIIGTVLVGPTPTNIIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69T_ES, M184V, L210W, T215F A62V Y181C, G190A A98AG V106VI, K122P, Q174R, I178L, V179I, G196E, Q197K, T200A, E203D, Q207E, R211K, L228H, V245M  
>1418-30820| codons 38-247
CTELEKEGKISKIGPENPYNTPVFVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSITVLDVGDAYFSVPLDPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPDLIICQYVDDLYVASDLEIEKHRAKIDELREHLWKWGFFTP
DKKHQKEPPFHWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006