<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1416 1416-30610 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, L90M G73S L10I, I13IMV, Q18H, K20R, M36I, I62V, L63P, I66IV, H69R, A71V, I93L, C95F, T96S  
>1416-30610| codons 4-99
TLWQRPIVTVKIGGHLREALLDTGADDTVLEEINLPGRWKPKIIGGIGGFVKVRQYDQVP
IEVCGRKVISTVLVGPTPTNIIGRNLMTQLGFSLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215F   K101E, Y181C, G190S   T39A, D121Y, K122E, I178M, T200A, Q207G, R211K, L228R, V245T  
>1416-30610| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMVICQYMDDLYVSSDLEIGQHRAKIEELRGHLLKWGFFTP
DKKHQKEPPFRWMGYELHPDKWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006