<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2272 2272-30804 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210GW, T215CY K219E Y188L A98G E44D, V60I, K122E, V179I, T200A, I202V, H208Y, R211K, W212M, L228H, V245E  
>2272-30804| codons 38-247
CTELEKDGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIIYQYVDDLLVGSDLEIGQHRAKVEELRQYLWKMGFYTP
DEKHQKEPPFHWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, L90M L10F, L33F, Q58E, G73S, L89V V11VL, K14KR, I15V, L19I, K20V, M36I, D60E, I62V, L63P, H69KQ, V77I, I85V  
>2272-30804| codons 4-99
TLWQRPFLTIRVGGQIVEALLDTGADDTIFEEINLPGRWKPKIVGGIGGFIKVREYEQVP
IEICGQKAISTVLIGPTPVNIVGRNVMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006