<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1887 1887-30630 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215Y K219E Y188L   T39TA, K102M, V106I, K166R, I178M, V179I, T200A, E204ED, R211K, D237E  
>1887-30630| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKMKKSITVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDMIIYQYVDDLLVGSDLEIGQHRAKIEDLRQHLLKWGFYTP
DEKHQKEPPFLWMGYELHPEKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V L10F, L33F, Q58E L19I, K20R, E35D, N37E, R57K, I62V, L63AT, I64V, E65D, T74S, V77I, I85V, T91S  
>1887-30630| codons 4-99
TLWQRPFVTIKIGGQIREALLDTGADDTIFEDMELPGRWKPKIVGGIGGFIKVKEYDQVT
VDICGHKAIGSVLIGPTPVNIVGRNLLSQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006