<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1891 1891-30619 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215CY K219E L100LI, K103N, Y181I   E44D, V60VI, S68SG, K122E, I135L, S162Y, V179I, R211K, L228H  
>1891-30619| codons 38-247
CTELEKDGKISKIGPENPYNTPIFAIKKKNGTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDIIIIQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTP
DEKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, I54T, V82S   L10I, I15V, K20M, E35D, M36I, R41K, I62V, L63P, A71L, I93L  
>1891-30619| codons 4-99
TLWQRPIVTIKVGGQLMEALLDTGADDTVLEDINLPGKWKPKIIVGIGGFTKVRQYDQVP
IEICGHKLIGTVLVGPTPSNIIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006