<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1122 1122-30312 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IATV, V82VA, I84IV L24I, L33LF L10I, R41RK, I62V, L63P, A71V, I72LV, N83NS, I85IMV, I93L  
>1122-30312| codons 4-99
TLWQRPIVTIKIGGQLKEALIDTGADDTVFEEMNLPGKWKPKIIGGIGGFVKVRQYDQVP
IEICGHKVVGTVLVGPTPASVVGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69DN, K70R T215P, K219R L100LI, K103N   V90VI, K102R, V118I, K122E, D123DN, I135IT, E203EK, R206RK, H208HY, R211K, F214L, L228HQ  
>1122-30312| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSNRWRKLVDFRELNKRTQDFWEIQLGIPHP
AGIKRNKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIKELKQYLLKWGLPTP
DRKHQKEPPFQWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006