<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2466 2466-30820 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, I84V, L90M L33F, K43KT, F53FL, G73T L10I, I13V, E34Q, K55KN, D60E, I62V, L63P, A71I, V77I, I93L I85IL
>2466-30820| codons 4-99
TLWQRPIVTVKIGGQLKEALLDTGADDTIFQEMNLPGRWTPKIVGGIGGLLNVRQYEQVP
IEICGHKIITTVLIGPTPVNVLGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y K219R Y181C A98G K43Q, E44D, V111I, D123E, I142IT, D177DE, T200A, E203K, Q207D, H208Y, R211K, K223Q  
>2466-30820| codons 38-247
CTELEQDGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDIGDAYFSVPLDKEFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVICQYVDDLYVGSDLEIGQHRAKIKELRDYLWKWGFYTP
DRKHQQEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006