<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2257 2257-30818 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M, M184V V75I, F77L, F116Y, K219E Y181C   S68G, A98S, K102KN, K122E, Q174HR, T200A, Q207E, R211K  
>2257-30818| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLIDLRELNKRTQDFWEVQLGIPHP
SGLKNKKSVTVLDVGDAFYSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKRNPDIVICQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTP
DEKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, I84V, L90M L33F, T74P L10I, V11L, I13V, K20R, E34Q, E35D, M36I, N37D, D60E, I62V, L63P, A71V, I93L  
>2257-30818| codons 4-99
TLWQRPILTVKIGGQLREALLDTGADDTVFQDIDLPGRWKPKMIGGIGGFLKVRQYEQVP
IEICGHKVIGPVLVGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006