<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2255 2255-30717 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, V82T, L90M L89V L10I, K20R, E35D, M36L, N37D, R57RK, L63P, I64M, C67E, A71V, I72V, I85IV, I93L  
>2255-30717| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTILEDLDLPGRWKPKIVGGIGGFIKVKQYDQIP
MEIEGHKVVGTVLVGPTPTNIVGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, Y115F, M184V, T215F D67G, K219E     S68G, D123E, I135T, I142V, D177E, T200A  
>2255-30717| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKGGTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAFFSVPLDKEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFFTP
DEKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006