<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1110 1110-30409 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M V11I, Q58E, G73T L10I, T12TP, I15IV, K20I, L33LV, M36MI, I62V, L63P, I64IV, A71IT, I72T, V77VI, I93L I13S
>1110-30409| codons 4-99
TLWQRPIIPSKVGGQLIEALLDTGADDTVVEEINLPGRWKPKIIGGIGGFVKVREYDQVP
VEICGHKTTTTVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_SS, M184I, T215Y   Y188L V179E K43Q, K64KR, W88C, V118I, K122E, Q197K, T200E N54NI
>1110-30409| codons 38-247
CTELEQEGKISKIGPEIPYNTPVFAIRKKDSSKWRKLVDFRELNKRTQDFCEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIEIYQYIDDLLVGSDLEIGKHREKIEELRQHLLRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006