<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
143P11 143P11W0 U.S. 1991 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 40

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R       D121H, K122E, I142V, I178M, V179I, R211K  
>143P11W0| codons 26-242
LTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTRWRKLVDFRELNKRTQ
DFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSINNETPGVRYQ
YNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMIIYQYMDDLYVGSDLEIGQHRTKIEEL
RQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, K55KE, L63P K45P
>143P11W0| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPPMIGGIGGFIEVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Winters, MA Human immunodeficiency virus type 1 reverse transcriptase genotype and drug susceptibility changes in infected individuals receiving dideoxyinosine monotherapy for 1 to 2 years. AAC, 1997
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005