<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2048 2048-30819 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M   L10LI, T12N, L19LI, N37D, D60E, L63P, A71V, V77I, I93L  
>2048-30819| codons 4-99
TLWQRPIVNIKIGGQIKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYEQIP
IEICGHKVIGTVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, L74LV, T215TNSY   Y181V   S68SN, K122E, D123E, I135T, S162C, Q174K, T200I, R211K, F214FL, E224ED  
>2048-30819| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKRKDNTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKKNPDIVIVQYMDDLYVGSDLEIGQHRIKIEELRQHLLKWGLYTP
DKKHQKDPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006