<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1390 1390-30813 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, I84V, L90M L33I L10I, G16E, N37Q, P39S, R41RK, L63H, A71V, I72T, V77I, I85V, I93L  
>1390-30813| codons 4-99
TLWQRPIVTIKIEGQLKEALLDTGADDTVIEEMQLSGKWKPKIIGGIGGFMKVRQYDQIH
IEICGHKVTGTVLIGPTPVNVVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   K103N   K43E, V118VI, K122E, I178M, T200A, E203D, Q207E, H208Y, R211K, L228H V111M, D113N, D177DGNS
>1390-30813| codons 38-247
CTELEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDMGNAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPSMVIYQYVDDLYVGSDLEIGQHRAKIDELREYLWKWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006