<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1389 1389-30623 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13IM, K14KR, N37D, R57K, I62V, L63P, A71T, V77I, I93L  
>1389-30623| codons 4-99
TLWQRPLVTMRIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVKQYDQVP
IEICGHKTIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   D123E, I135IM, I142V, E169D, T200A, R211RG, V245I D113DN
>1389-30623| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGNAYFSVPLDKEFRKYTAFTIPSMNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILDPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRAKIEELRQHLLGWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIILP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006