<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1387 1387-30521 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V T215V, K219Q K103N V179E, P225H V118I, L120*, K122E, D123DN, E138Q, T200A, Q207E, R211K, F214L, L228H  
>1387-30521| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIP*DENFRKYTAFTIPSINNQTPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIEIYQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLVTP
DQKHQKEHPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82S L24I, K43T L10I, T12S, I15V, L19I, E35D, M36MIV, N37H, R41K, K55R, I62V, L63P, I66V, H69R, K70T, T74S, V77I, I93L, C95F D29DV
>1387-30521| codons 4-99
TLWQRPIVSIKVGGQIKEALIDTGAVDTVLEDVHLPGKWTPKIIGGIGGFVRVRQYDQVP
IEVCGRTAIGSVLIGPTPSNIIGRNLLTQLGFTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006