<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1385 1385-30512 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54L, V82T L24I, F53L L10I, T12P, Q18M, R41K, K55R, I62IV, L63P, I64V, T74S, I85V  
>1385-30512| codons 4-99
TLWQRPIVPIKIGGMLKEALIDTGADDTVLEEMNLPGKWKPKIIGGIGGLLRVRQYDQVP
VEICGHKAIGSVLVGPTPTNIVGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V, T215F K219Q     K49R, V60I, D123E, S162D, K166R, E169D, T200A, I202IV, E203D, H208HY, R211K  
>1385-30512| codons 38-247
CTEMEKEGKISRIGPENPYNTPIFAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQDSMTRILDPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKVDELRQYLLKWGFFTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006