<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2250 2250-30729 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70G D67DG V106A F227L D123E, I142IT, S162R, I178L, Q207E, K238R, I244L, V245E Q161K
>2250-30729| codons 38-246
CTEMEKEGKISKIGPENPYNTPVFAIKKKGSTGWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSATVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSP
AIFKRSMTKILEPFRKQNPDLVIYQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTP
DKKHQKEPPLLWMGYELHPDRWTVQPLEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M N88D I15V, N37E, P39S, I62V, L63P, A71V, I72M  
>2250-30729| codons 4-99
TLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMELSGRWKPKIIGGIGGFIKVRQYDQVP
IEICGHKVMGTVLVGPTPVNIIGRDLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006