<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1108 1108-30624 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54S, V82A L24I L10I, I62V, L63P, H69R, A71V, I72V, V77I  
>1108-30624| codons 4-99
TLWQRPIVTIKIGGQLKEALIDTGADDTVLEEMNLPGRWKPKMIVGIGGFSKVRQYDQVP
IEICGRKVVGTVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y K70KI, V75M, F77L     T69TN, V118I, K122E, I135L, I142IT, Q145QR, S162D, R211K, L228R  
>1108-30624| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSNIWRKLMDLRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSLNNETPGTRYRYNVLPQGWKGSP
AIFQDSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTP
DKKHQKEPPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006