<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1107 1107-30617 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V, I54M, I84V, L90M V11VI, L33F, L89V L10I, I13V, I15V, L19Q, K20R, M36I, N37S, R41K, Q61H, L63P, K70R, A71V, V82I, Q92R  
>1107-30617| codons 4-99
TLWQRPIITVKVGGQQREALLDTGADDTIFEEISLPGKWKPKMVGGIGGFMKVRQYDHIP
IEICGHRVIGTVLVGPTPINVIGRNVMTRIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, V75M, M184V, L210W, T215F   K103N, M230L   K43E, D123E, I135T, S162C, K166R, D177E, G196E, T200A, E204Q, Q207E, R211K, L228R N137H
>1107-30617| codons 38-247
CTELEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSTNHETPGIRYQYNVLPQGWKGSP
AIFQCSMTRILEPFRKQNPEIVIYQYVDDLYVGSDLEIEQHRAKIEQLREHLWKWGFFTP
DKKHQKEPPFRWLGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006