<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1104 1104-30610 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54M, I84V, L90M Q58E, G73S L10I, T12K, I15V, L19P, K20I, E34Q, M36I, L63P, A71V, I85V  
>1104-30610| codons 4-99
TLWQRPIVKIKVGGQPIEALLDTGADDTVLQEINLPGRWKPKIVGGIGGFMKVREYDQIP
IEICGHKVISTVLVGPTPVNVVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219Q Y188YFHL A98G V60VI, V106VI, K122E, D123E, I135V, S162C, E169D, Q174E, I178L, T200A, E203ED, H208HY, V245E  
>1104-30610| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSITVLDVGDAYFSVPLDEEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILDPFRKENPDLVIYQYVDDLLVGSDLEIGQHRAKIDELRQYLLRWGFFTP
DQKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006