<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1106 1106-30617 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219KNRS K103N, Y181C   T39E, E44D, D123E, I135V, Q174R, E203K, R211K, K223E, L228H, K238KI P226PT
>1106-30617| codons 38-247
CEELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPDIVICQYMDDLYVGSDLEIGQHRTKIKELRQHLWKWGFYTP
DSKHQEEPTFHWMGYELHPDIWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M F53L, G73GS L10I, E35D, M36MI, N37E, L63P, A71V  
>1106-30617| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEDIELPGRWKPKIIGGIGGLIKVRQYDQIP
IEICGHKVISTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006