<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1382 1382-30430 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I47V, G48GMRV, I54V, V82A, L90M L33F, F53FL, G73S L10I, G16A, E34Q, R41K, D60E, I62V, L63P, A71V, V77I, I93L  
>1382-30430| codons 4-99
TLWQRPIVTIKIAGQLKEALLDTGADDTVFQEMNLPGKWKPKIVVGIGGLVKVRQYEQVP
IEICGHKVISTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184V, L210W, T215Y       T39E, E44D, D86DE, V118I, K122E, I135T, G196E, Q197E, R211K, V245EK  
>1382-30430| codons 38-247
CEELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLMDFRELNKRTQEFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEEHRTKIEELRQHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006