<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1376 1376-30722 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   K103N   T39TA, K43KQ, V60I, V118I, K122E, E138A, S162C, T200A, R211T  
>1376-30722| codons 38-247
CAELEQEGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRAKIEELRQHLWTWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54L, L90M L33F, G73S L10I, I13V, G17GE, R41K, I62V, L63P, V77I, I93L  
>1376-30722| codons 4-99
TLWQRPIVTVKIGEQLKEALLDTGADDTVFEEMNLPGKWKPKLIGGIGGFLKVRQYDQVP
IEICGHKAISTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006