<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1375 1375-30626 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215F A62V Y181C, G190A   R83RG, K122P, Q174R, I178L, V179I, G196E, Q197K, T200A, E203D, Q207E, R211K, L228H, V245M  
>1375-30626| codons 38-247
CTELEKEGKISKIGPENPYNTPVFVIKKKDSTKWRKLVDFRELNKGTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPDLIICQYVDDLYVASDLEIEKHRAKIDELREHLWKWGFFTP
DKKHQKEPPFHWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006