<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1374 1374-30623 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, L74V, Q151M, T215Y D67H, K219Q K103N, Y181C, G190A V179FY T69N, W88WC, K122P, R172RK, D177E, I202IV, R211K, F214FL, H221Y, E224ED  
>1374-30623| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKHSNRWRKVVDFRELNKRTQDFCEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDPDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFKKQNPEIYICQYMDDLYVASDLEIGQHRTKVEELRQHLLKWGLYTP
DQKYQKDPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L33F, N88D L10I, K20R, E35D, M36I, R41E, K55R, I62V, L63P, I64L, I66IV, H69R, A71T, I72E, Q92K, C95F  
>1374-30623| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTVFEDINLPGEWKPKIIGGIGGFVRVRQYDQVP
LEVCGRKTEGTVLVGPTPVNVIGRDLMTKIGFTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006