<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2139 2139-30818 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, V82VA, I84V, L90M L33F, F53L, T74P L10I, I13V, N37D, R41K, I62IV, L63P, A71V, I72IV, I93M L5V
>2139-30818| codons 4-99
TVWQRPIVTVKIGGQLKEALLDTGADDTVFEEMDLPGKWKPKLIGGIGGLIKVRQYDQVP
IEICGHKVVGPVLVGPTPANVIGRNLMTQMGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219N K103KN   K43N, V60VI, W88WC, V118I, K122E, I135T, S162Y, T200A, H208Y, R211K  
>2139-30818| codons 38-247
CTELENEGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFCEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRAKIEELRQYLWKWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006