<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2146 2146-30708 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, I84V, L90M L33F, G73S L10I, K55KR, R57K, L63P, C67W, A71IV, Q92K, I93L  
>2146-30708| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTIFEEMNLPGRWKPKIVGGIGGFMRVKQYDQIP
IEIWGHKVISTVLVGPTPVNVIGRNLMTKLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N K219Q K103N   K122E, Q174R, I178L, D192H, G196E, T200I, Q207K, R211A, Q242H  
>2146-30708| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPDLVIYQYMDDLYVGSHLEIEQHRIKIEELRKHLLAWGFTTP
DQKHQKEPPFLWMGYELHPDKWTVHPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006