<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2145 2145-30707 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, L76V, I84V, L90M L33F, G73S, L89V L10I, I13IV, L19LI, E34EQ, D60E, I62V, L63P, A71V, V77I, I93L  
>2145-30707| codons 4-99
TLWQRPIVTVKIGGQIKEALLDTGADDTVFQEMNLPGRWKPKIIGGIGGFMKVRQYEQVP
IEICGHKVISTVVIGPTPVNVIGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y A62V K103N, Y188L   K49R, K102Q, K122E, L168*, I178L, H208Y, R211K, L228LH  
>2145-30707| codons 38-247
CTELEKEGKISRIGPENPYNTPVFVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKQNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKI*EPFRKQNPDLVIYQYVDDLLVGSDLEIGQHRTKIEELRQYLWKWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006