<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2004 2004-30623 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, T215F V75T, K219Q   A98G T69TN, V118I, K122E, D123G, I135IT, K173E, E203D, H208Y, F214L, K223E, L228H  
>2004-30623| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSNRWRKITDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAYFSIPLDEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFREQNPDIVIYQYVDDLYVGSDLEIGQHRTKIDELRQYLLRWGLFTP
DQKHQEEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V, I54L, I84V, L90M L33F, M46V, G73T L10V, I15V, L19I, K20R, E34A, E35D, M36I, P39S, L63P, I66IV  
>2004-30623| codons 4-99
TLWQRPVVTIKVGGQIREALLDTGADDTIFADINLSGRWKPKVVGGIGGFLKVRQYDQIP
IEVCGHKAITTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006