<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1879 1879-30605 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54A, V82A L24I, L33F, K43T L10I, M36L, N37D, D60E, I62V, L63P, I64V, A71T, T91A  
>1879-30605| codons 4-99
TLWQRPIVTIKIGGQLKEALIDTGADDTVFEELDLPGRWTPKMIVGIGGFAKVRQYEQVP
VEICGHKTIGTVLVGPTPANIIGRNLLAQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70RS, V75M, M184V, L210W, T215Y K219E   A98AG T39A, E44D, S68G, V118VI, D121DH, K122E, I135L, R211K, L228H, P243T, V245E  
>1879-30605| codons 38-247
CAELEKDGKISKIGPENPYNTPVFAIKKKNGTSWRKLMDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAYFSIPLHEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTP
DEKHQKEPPFHWMGYELHPDKWTVQTIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006