<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1878 1878-30604 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, L90M F53FL, G73T, N83ND L10I, I15IV, E34EAKT, L38W, P39Q, I62V, L63P, I64V, A71V, V77VI  
>1878-30604| codons 4-99
TLWQRPIVTIKVGGQLKEALLDTGADDTILTEMNWQGRWKPKIVGGIGGLMKVRQYDQVP
VEICGHKVITTVLIGPTPVDIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y   Y181YDFV, Y188Y*FL   T39A, K43Q, K49KR, I50IV, S68G, V118I, K122E, I142IM, S162N, Q174QR, R211K E53EK, L100L*
>1878-30604| codons 38-247
CAELEQEGKISRVGPKNPYNTPVFAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AG*KKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGMRYQYNVLPQGWKGSP
AIFQNSMTKILEPFRKRNPDIVIVQYVDDLLVGSDLEIGQHRTKIEELRQHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006