<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1876 1876-30529 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M Q58E L10IV, K20R, M36I, K55R, L63P, A71V, I72IT, Q92K, I93M  
>1876-30529| codons 4-99
TLWQRPVVTIKIGGQLREALLDTGADDTVLEEINLPGRWKPKLIGGIGGFVRVREYDQIP
IEICGHKVTGTVLVGPTPANIIGRNLMTKMGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184V, L210W T215D K103N   K43KN, V60I, V118I, D121H, K122E, D123E, I135T, D177DN, D192DN, G196E, E203EK, H208Y, R211K, K223Q  
>1876-30529| codons 38-247
CTELENEGKISKIGPENPYNTPIFAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLHEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPNIVIYQYVDDLYVGSNLEIEQHRTKIKELRQYLWKWGFDTP
DKKHQQEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006