<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1875 1875-30528 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46*L, G48V, I54S, V82A   L10I, K14KR, N37D, L63P, K70KE, A71V, V77I, I93L  
>1875-30528| codons 4-99
TLWQRPIVTIRIGGQLKEALLDTGADDTVLEEMDLPGRWKPKLIVGIGGFSKVRQYDQIP
IEICGHEVIGTVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219N Y181C, G190A K101H K43E, E44A, V118I, K122E, D123DN, I142V, Q174L, N175Y, T200A, K201R, Q207E, R211K, L228H, V245T  
>1875-30528| codons 38-247
CTELEEAGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLHKKKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKLYPDIVICQYVDDLYVASDLEIGQHRARIEELREHLWKWGFYTP
DNKHQKEPPFHWMGYELHPDKWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006