<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1692 1692-30423 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, G48GA, I54V, V82A, L90M L33F, K43T, T74TP L10I, I13V, K20R, E35D, M36I, N37S, R41K, K55KR, I62V, L63P, A71T, I93L  
>1692-30423| codons 4-99
TLWQRPIVTVKIGGQLREALLDTGADDTVFEDISLPGKWTPKLIAGIGGFVRVRQYDQVP
IEICGHKTIGPVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y   G190A K101H V118VI, K122KE, D123DN, V179VI, R211RK, F214FL K43KHNQ
>1692-30423| codons 38-247
CTELEQEGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLHKKKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIIYQYVDDLYVASDLEIGQHRTKIEELRQHLWKWGLYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006