<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1695 1695-30429 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V, I54M, I84V, L90M L10F, Q58E, G73S, L89V G16GA, K20I, M36I, I62V, L63P, A71V, Q92K  
>1695-30429| codons 4-99
TLWQRPFVTIKIAGQLIEALLDTGADDTILEEINLPGRWKPKMVGGIGGFMKVREYDQVP
IEICGHKVISTVLVGPTPVNVIGRNVMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, V75T, M184V, L210W, T215Y A62V, K219R K101E, G190A   K43Q, V106I, V118I, K122E, I135T, Q207QK, R211K, F214L, K223Q, L228H, Q242K  
>1695-30429| codons 38-247
CTELEQEGKISKIGPENPYNTPVFVIKKKDSTKWRKLTDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSITVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVASDLEIGQHRTKIEELRKHLWKWGLYTP
DRKHQQEPPFHWMGYELHPDKWTVKPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006