<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1693 1693-30423 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, L74LV, T215Y D67G K103N K238T V60I, I135T, S162Y, V179L, V245K  
>1693-30423| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKGSDKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDILIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTP
DKKHQKEPPFLWMGYELHPDTWTVQPIKLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54M, V82C, I84V L24I, L33F, K43T L10I, I13V, K20KR, E35D, M36I, L63P, K70KE, A71V  
>1693-30423| codons 4-99
TLWQRPIVTVKIGGQLREALIDTGADDTVFEDINLPGRWTPKMIGGIGGFMKVRQYDQIP
IEICGHEVIGTVLVGPTPCNVIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006