<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1628 1628-30416 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L33F, F53L L10V, G16A, L24F, R41K, L63P, I64L, A71V, I72V, V77I, T91S, I93L  
>1628-30416| codons 4-99
TLWQRPVVTIKIAGQLKEALFDTGADDTVFEEMNLPGKWKPKLIGGIGGLVKVRQYDQIP
LEICGHKVVGTVLIGPTPANIIGRNLMSQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219N   F227FL T39A, E44D, V118I, K122E, S162C, E169D, G196E, E203K, Q207E, H208Y, R211K, K223E  
>1628-30416| codons 38-247
CAELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILDPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIKELREYLWKWGFYTP
DNKHQEEPPLLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006