<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1630 1630-30417 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M L10F, F53L, G73S I15V, G16A, L19P, K20M, M36I, N37NS, R41K, L63P, A71V, I93L  
>1630-30417| codons 4-99
TLWQRPFVTIKVAGQPMEALLDTGADDTVLEEISLPGKWKPKIIGGIGGLVKVRQYDQIP
IEICGHKVISTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y   K103N   K43E, V118I, K122E, I135T, Q174H, T200A, I202V, Q207E, R211K, E224ED, I244V, V245I N57H
>1630-30417| codons 38-247
CTELEEEGKISKIGPENPYHTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKHNPDIVIYQYVDDLYVGSDLEIGQHRAKVEELREHLWKWGFYTP
DKKHQKDPPFLWMGYELHPDKWTVQPVILP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006