<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1624 1624-30324 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M V11I, K43T L10I, I15V, K20I, E35D, M36I, K55KR, I62V, L63P, A71V, I72L, I85V, Q92K, C95L  
>1624-30324| codons 4-99
TLWQRPIITIKVGGQLIEALLDTGADDTVLEDINLPGRWTPKLIGGIGGFVRVRQYDQVP
IEICGHKVLGTVLVGPTPANIVGRNLMTKIGLTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215Y D67G, K219DN K103KN   T39TS, E44D, I50IM, S68G, V118VI, K122E, I142IV, S162Y, G196GE, T200TA, E203EK, H208HY, V245T  
>1624-30324| codons 38-247
CSELEKDGKISKMGPENPYNTPVFAIKKKGGTKWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRAKIKELRQYLWRWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006