<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1619 1619-30317 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 NNRTI|NRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V L10FV I13V, R41H, F53I, D60E, L63P, I64V, K70R, A71V, V77VI, P79AS, I93L  
>1619-30317| codons 4-99
TLWQRPVVTVKIGGQLKEALLDTGADDTVLEEMNLPGHWKPKIIGGIGGIIKVRQYEQIP
VEICGHRVIGTVLIGSTPVNVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y   K103N V108VI, K238KT K43N, V60VI, A98S, K122KE, Q174QK, N175NY, I178IM, T200E, H221HY  
>1619-30317| codons 38-247
CTELENEGKISKIGPENPYNTPIFAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHP
SGLKKNKSVTILDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKKYPDMVIYQYVDDLYVGSDLEIGQHREKIEELRQHLWRWGFYTP
DKKYQKEPPFLWMGYELHPDTWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006