<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1621 1621-30317 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, I84V, L90M V11I, F53FL, L89V L10I, I13A, K20I, E35D, M36I, N37HQ, R57RK, Q61H, I62IV, L63P, A71V, I72E, T91TS, Q92K  
>1621-30317| codons 4-99
TLWQRPIITAKIGGQLIEALLDTGADDTVLEDIQLPGRWKPKIVGGIGGLVKVKQYDHVP
IEICGHKVEGTVLVGPTPVNVIGRNVMSKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LI, M184V, L210W, T215Y   K103N V108I K43N, E44D, V118I, K122E, I142V, Q174K, N175Y, G196GE, T200A, E203D, Q207E, H208Y, R211K, L228H, Q242H  
>1621-30317| codons 38-247
CTELENDGKISKIGPENPYNTPVFAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTILDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKKYPDIVIYQYVDDLYVGSDLEIEQHRAKIDELREYLWKWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVHPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006